RNF168 antibody (C-Term)

Catalog No. ABIN631390

Product Details anti-RNF168 Antibody

Target: RNF168 (Ring Finger Protein 168 (RNF168))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF168 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RNF168 antibody was raised against the C terminal of RNF168

Purification: Affinity purified

Immunogen: RNF168 antibody was raised using the C terminal of RNF168 corresponding to a region with amino acids PCFSAKRRKVSPESSPDQEETEINFTQKLIDLEHLLFERHKQEEQDRLLA

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF168 Blocking Peptide, catalog no. 33R-6996, is also available for use as a blocking control in assays to test for specificity of this RNF168 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF168 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF168

Target: RNF168 (Ring Finger Protein 168 (RNF168))

Alternative Name: RNF168 (RNF168 Products)

Synonyms: 3110001H15Rik antibody, hRNF168 antibody, ring finger protein 168 antibody, ring finger protein 168, E3 ubiquitin protein ligase L homeolog antibody, Rnf168 antibody, rnf168.L antibody, RNF168 antibody

Background: The complex repair response elicited by DNA double-strand breaks (DSBs) includes recruitment of several DNA repair proteins and ubiquitination of H2A-type histones. RNF168 is an E3 ubiquitin ligase critical for DSB repair.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response