TRIM42 antibody (C-Term)

Catalog No. ABIN631389

Product Details anti-TRIM42 Antibody

Target: TRIM42 (Tripartite Motif Containing 42 (TRIM42))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM42 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRIM42 antibody was raised against the C terminal of TRIM42

Purification: Affinity purified

Immunogen: TRIM42 antibody was raised using the C terminal of TRIM42 corresponding to a region with amino acids VKTPGPIVIYQTLVYPRAAKVYWTCPAEDVDSFEMEFYEVITSPPNNVQM

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM42 Blocking Peptide, catalog no. 33R-9638, is also available for use as a blocking control in assays to test for specificity of this TRIM42 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM42

Target: TRIM42 (Tripartite Motif Containing 42 (TRIM42))

Alternative Name: TRIM42 (TRIM42 Products)

Synonyms: TRIM42 antibody, PPP1R40 antibody, 4930486B16Rik antibody, tripartite motif containing 42 antibody, tripartite motif-containing 42 antibody, TRIM42 antibody, Trim42 antibody

Background: TRIM42 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.

Molecular Weight: 80 kDa (MW of target protein)