TRIM43 antibody (C-Term)

Catalog No. ABIN631387

Product Details anti-TRIM43 Antibody

Target: TRIM43 (Tripartite Motif Containing 43 (TRIM43))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM43 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRIM43 antibody was raised against the C terminal of TRIM43

Purification: Affinity purified

Immunogen: TRIM43 antibody was raised using the C terminal of TRIM43 corresponding to a region with amino acids NSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFES

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM43 Blocking Peptide, catalog no. 33R-6890, is also available for use as a blocking control in assays to test for specificity of this TRIM43 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM43 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM43

Target: TRIM43 (Tripartite Motif Containing 43 (TRIM43))

Alternative Name: TRIM43 (TRIM43 Products)

Synonyms: TRIM43A antibody, tripartite motif containing 43 antibody, TRIM43 antibody

Background: TRIM43 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger, 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of TRIM43 remains unknown.

Molecular Weight: 52 kDa (MW of target protein)