RSPRY1 antibody (N-Term)

Catalog No. ABIN631386

Product Details anti-RSPRY1 Antibody

Target: RSPRY1 (Ring Finger and SPRY Domain Containing 1 (RSPRY1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RSPRY1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RSPRY1 antibody was raised against the N terminal of RSPRY1

Purification: Affinity purified

Immunogen: RSPRY1 antibody was raised using the N terminal of RSPRY1 corresponding to a region with amino acids RSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RSPRY1 Blocking Peptide, catalog no. 33R-8205, is also available for use as a blocking control in assays to test for specificity of this RSPRY1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSPRY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RSPRY1

Target: RSPRY1 (Ring Finger and SPRY Domain Containing 1 (RSPRY1))

Alternative Name: RSPRY1 (RSPRY1 Products)

Synonyms: si:ch211-257c9.1 antibody, 4930470D19Rik antibody, AI608258 antibody, RGD1308847 antibody, ring finger and SPRY domain containing 1 antibody, ring finger and SPRY domain containing 1 S homeolog antibody, RSPRY1 antibody, rspry1 antibody, rspry1.S antibody, Rspry1 antibody

Background: RSPRY1 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of RSPRY1 remains unknown.

Molecular Weight: 64 kDa (MW of target protein)