FBXO11 antibody (Middle Region)
-
- Target See all FBXO11 Antibodies
- FBXO11 (F-Box Protein 11 (FBXO11))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FBXO11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FBXO11 antibody was raised against the middle region of FBXO11
- Purification
- Affinity purified
- Immunogen
- FBXO11 antibody was raised using the middle region of FBXO11 corresponding to a region with amino acids HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ
- Top Product
- Discover our top product FBXO11 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FBXO11 Blocking Peptide, catalog no. 33R-3713, is also available for use as a blocking control in assays to test for specificity of this FBXO11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO11 (F-Box Protein 11 (FBXO11))
- Alternative Name
- FBXO11 (FBXO11 Products)
- Background
- FBXO11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.
- Molecular Weight
- 94 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-