FBXO11 antibody (Middle Region)

Catalog No. ABIN631382

Product Details anti-FBXO11 Antibody

Target: FBXO11 (F-Box Protein 11 (FBXO11))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO11 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXO11 antibody was raised against the middle region of FBXO11

Purification: Affinity purified

Immunogen: FBXO11 antibody was raised using the middle region of FBXO11 corresponding to a region with amino acids HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO11 Blocking Peptide, catalog no. 33R-3713, is also available for use as a blocking control in assays to test for specificity of this FBXO11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO11

Target: FBXO11 (F-Box Protein 11 (FBXO11))

Alternative Name: FBXO11 (FBXO11 Products)

Synonyms: FBX11 antibody, PRMT9 antibody, UBR6 antibody, VIT1 antibody, C80048 antibody, Jf antibody, Vit1 antibody, fbxo11 antibody, MGC84634 antibody, FBXO11 antibody, im:6906507 antibody, wu:fj83f06 antibody, zgc:153171 antibody, Fbxo11 antibody, DKFZp459P2410 antibody, F-box protein 11 antibody, F-box protein 11 L homeolog antibody, F-box protein 11a antibody, F-box only protein 11 antibody, hypothetical protein antibody, FBXO11 antibody, Fbxo11 antibody, fbxo11.L antibody, fbxo11a antibody, CpipJ_CPIJ009919 antibody, CpipJ_CPIJ017549 antibody, Bm1_52225 antibody, LOAG_16571 antibody, fbxo11 antibody, LOC100115478 antibody

Background: FBXO11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.

Molecular Weight: 94 kDa (MW of target protein)

Pathways: Sensory Perception of Sound