RNF219 antibody (N-Term)
-
- Target See all RNF219 products
- RNF219 (Ring Finger Protein 219 (RNF219))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNF219 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C13 ORF7 antibody was raised against the N terminal Of C13 rf7
- Purification
- Affinity purified
- Immunogen
- C13 ORF7 antibody was raised using the N terminal Of C13 rf7 corresponding to a region with amino acids LVTDNPSKINPETVAEWKKKLRTANEIYEKVKDDVDKLKEANKKLKLENG
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C13ORF7 Blocking Peptide, catalog no. 33R-5543, is also available for use as a blocking control in assays to test for specificity of this C13ORF7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF219 (Ring Finger Protein 219 (RNF219))
- Alternative Name
- C13ORF7 (RNF219 Products)
- Synonyms
- C13orf7 antibody, 2610206B13Rik antibody, 2810449K13Rik antibody, AI451544 antibody, ring finger protein 219 antibody, RNF219 antibody, Rnf219 antibody
- Background
- The function of C13orf7 has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 80 kDa (MW of target protein)
-