RNF219 antibody (N-Term)

Catalog No. ABIN631380

Product Details anti-RNF219 Antibody

Target: RNF219 (Ring Finger Protein 219 (RNF219))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF219 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C13 ORF7 antibody was raised against the N terminal Of C13 rf7

Purification: Affinity purified

Immunogen: C13 ORF7 antibody was raised using the N terminal Of C13 rf7 corresponding to a region with amino acids LVTDNPSKINPETVAEWKKKLRTANEIYEKVKDDVDKLKEANKKLKLENG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C13ORF7 Blocking Peptide, catalog no. 33R-5543, is also available for use as a blocking control in assays to test for specificity of this C13ORF7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF219

Target: RNF219 (Ring Finger Protein 219 (RNF219))

Alternative Name: C13ORF7 (RNF219 Products)

Synonyms: C13orf7 antibody, 2610206B13Rik antibody, 2810449K13Rik antibody, AI451544 antibody, ring finger protein 219 antibody, RNF219 antibody, Rnf219 antibody

Background: The function of C13orf7 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 80 kDa (MW of target protein)