TRIM49 antibody (N-Term)

Catalog No. ABIN631376

Product Details anti-TRIM49 Antibody

Target: TRIM49 (Tripartite Motif Containing 49 (TRIM49))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM49 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRIM49 antibody was raised against the N terminal of TRIM49

Purification: Affinity purified

Immunogen: TRIM49 antibody was raised using the N terminal of TRIM49 corresponding to a region with amino acids RPCFYLNWQDIPFLVQCSECTKSTEQINLKTNIHLKKMASLARKVSLWLF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM49 Blocking Peptide, catalog no. 33R-8089, is also available for use as a blocking control in assays to test for specificity of this TRIM49 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM49 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM49

Target: TRIM49 (Tripartite Motif Containing 49 (TRIM49))

Alternative Name: TRIM49 (TRIM49 Products)

Synonyms: RNF18 antibody, TRIM49A antibody, TRIM49L2 antibody, tripartite motif containing 49 antibody, TRIM49 antibody

Background: TRIM49 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein has been found to be preferentially expressed in testis.

Molecular Weight: 53 kDa (MW of target protein)