FBXO21 antibody (N-Term)

Catalog No. ABIN631372

Product Details anti-FBXO21 Antibody

Target: FBXO21 (F-Box Protein 21 (FBXO21))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO21 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXO21 antibody was raised against the N terminal of FBXO21

Purification: Affinity purified

Immunogen: FBXO21 antibody was raised using the N terminal of FBXO21 corresponding to a region with amino acids KEQFRVRWPSLMKHYSPTDYVNWLEEYKVRQKAGLEARKIVASFSKRFFS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO21 Blocking Peptide, catalog no. 33R-4350, is also available for use as a blocking control in assays to test for specificity of this FBXO21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO21

Target: FBXO21 (F-Box Protein 21 (FBXO21))

Alternative Name: FBXO21 (FBXO21 Products)

Synonyms: FBX21 antibody, 2810425J22Rik antibody, AU016673 antibody, mKIAA0875 antibody, si:ch211-42a13.2 antibody, F-box protein 21 antibody, FBXO21 antibody, Fbxo21 antibody, fbxo21 antibody

Background: FBXO21 contains 1 F-box domain. It is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.

Molecular Weight: 71 kDa (MW of target protein)