UBE2S antibody (N-Term)
-
- Target See all UBE2S Antibodies
- UBE2S (Ubiquitin-Conjugating Enzyme E2S (UBE2S))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UBE2S antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- UBE2 S antibody was raised against the N terminal of UBE2
- Purification
- Affinity purified
- Immunogen
- UBE2 S antibody was raised using the N terminal of UBE2 corresponding to a region with amino acids NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPE
- Top Product
- Discover our top product UBE2S Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UBE2S Blocking Peptide, catalog no. 33R-6884, is also available for use as a blocking control in assays to test for specificity of this UBE2S antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2S (Ubiquitin-Conjugating Enzyme E2S (UBE2S))
- Alternative Name
- UBE2S (UBE2S Products)
- Synonyms
- E2-EPF antibody, E2EPF antibody, EPF5 antibody, 0910001J09Rik antibody, 6720465F12Rik antibody, AA409170 antibody, RGD1564746 antibody, ube2s antibody, UBE2S antibody, DDBDRAFT_0188215 antibody, DDBDRAFT_0305006 antibody, DDB_0188215 antibody, DDB_0305006 antibody, e2-epf antibody, e2epf antibody, epf5 antibody, ube2s.1 antibody, ube2s.1-b antibody, ube2s.1-a antibody, ubiquitin conjugating enzyme E2 S antibody, ubiquitin-conjugating enzyme E2S antibody, ubiquitin-conjugating enzyme e2S, putative antibody, ubiquitin-conjugating enzyme E2 S antibody, ubiquitin conjugating enzyme E2 S S homeolog antibody, ubiquitin conjugating enzyme E2 S L homeolog antibody, UBE2S antibody, Ube2s antibody, ube2s antibody, ATEG_00324 antibody, Smp_180170 antibody, MCYG_01532 antibody, ube2s.S antibody, ube2s.L antibody
- Background
- UBE2S is a member of the ubiquitin-conjugating enzyme family. It is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins.
- Molecular Weight
- 24 kDa (MW of target protein)
- Pathways
- Ubiquitin Proteasome Pathway
-