F-Box Protein 3 antibody (N-Term)

Catalog No. ABIN631362

Product Details anti-F-Box Protein 3 Antibody

Target: F-Box Protein 3 (FBXO3)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This F-Box Protein 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXO3 antibody was raised against the N terminal of FBXO3

Purification: Affinity purified

Immunogen: FBXO3 antibody was raised using the N terminal of FBXO3 corresponding to a region with amino acids NCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO3 Blocking Peptide, catalog no. 33R-6651, is also available for use as a blocking control in assays to test for specificity of this FBXO3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for F-Box Protein 3

Target: F-Box Protein 3 (FBXO3)

Alternative Name: FBXO3 (FBXO3 Products)

Synonyms: FBA antibody, FBX3 antibody, 1200002G09Rik antibody, 1700026K02Rik antibody, AI046358 antibody, Fba antibody, zgc:112485 antibody, DKFZp459H187 antibody, F-box protein 3 antibody, F-box protein 3 S homeolog antibody, FBXO3 antibody, Fbxo3 antibody, fbxo3.S antibody, fbxo3 antibody

Background: FBXO3 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO3 belongs to the Fbxs class.

Molecular Weight: 47 kDa (MW of target protein)