WWP2 antibody (Middle Region)
-
- Target See all WWP2 Antibodies
- WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WWP2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- WWP2 antibody was raised against the middle region of WWP2
- Purification
- Affinity purified
- Immunogen
- WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids EMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYH
- Top Product
- Discover our top product WWP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WWP2 Blocking Peptide, catalog no. 33R-2586, is also available for use as a blocking control in assays to test for specificity of this WWP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WWP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))
- Alternative Name
- WWP2 (WWP2 Products)
- Synonyms
- aip2 antibody, wwp2-like antibody, id:ibd1121 antibody, wu:fo87e10 antibody, zgc:154036 antibody, AIP2 antibody, WWp2-like antibody, 1300010O06Rik antibody, AA690238 antibody, AW554328 antibody, WW domain containing E3 ubiquitin protein ligase 2 antibody, WWP2 antibody, wwp2 antibody, Wwp2 antibody
- Background
- WWP2 is a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. WWP2 contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions.
- Molecular Weight
- 47 kDa (MW of target protein)
- Pathways
- Negative Regulation of Transporter Activity
-