RFPL3 antibody (C-Term)
-
- Target See all RFPL3 products
- RFPL3 (Ret Finger Protein-Like 3 (RFPL3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RFPL3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RFPL3 antibody was raised against the C terminal of RFPL3
- Purification
- Affinity purified
- Immunogen
- RFPL3 antibody was raised using the C terminal of RFPL3 corresponding to a region with amino acids TVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPL
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RFPL3 Blocking Peptide, catalog no. 33R-9367, is also available for use as a blocking control in assays to test for specificity of this RFPL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFPL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RFPL3 (Ret Finger Protein-Like 3 (RFPL3))
- Alternative Name
- RFPL3 (RFPL3 Products)
- Synonyms
- RFPL3 antibody, ret finger protein like 3 antibody, ret finger protein-like 3 antibody, RFPL3 antibody, LOC738758 antibody, LOC100349961 antibody, LOC100357271 antibody
- Background
- The function of RFPL3 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 32 kDa (MW of target protein)
-