RFPL3 antibody (C-Term)

Catalog No. ABIN631355

Product Details anti-RFPL3 Antibody

Target: RFPL3 (Ret Finger Protein-Like 3 (RFPL3))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RFPL3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RFPL3 antibody was raised against the C terminal of RFPL3

Purification: Affinity purified

Immunogen: RFPL3 antibody was raised using the C terminal of RFPL3 corresponding to a region with amino acids TVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RFPL3 Blocking Peptide, catalog no. 33R-9367, is also available for use as a blocking control in assays to test for specificity of this RFPL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFPL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RFPL3

Target: RFPL3 (Ret Finger Protein-Like 3 (RFPL3))

Alternative Name: RFPL3 (RFPL3 Products)

Synonyms: RFPL3 antibody, ret finger protein like 3 antibody, ret finger protein-like 3 antibody, RFPL3 antibody, LOC738758 antibody, LOC100349961 antibody, LOC100357271 antibody

Background: The function of RFPL3 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 32 kDa (MW of target protein)