TRIM72 antibody (Middle Region)
-
- Target See all TRIM72 Antibodies
- TRIM72 (Tripartite Motif Containing 72 (TRIM72))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRIM72 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRIM72 antibody was raised against the middle region of TRIM72
- Purification
- Affinity purified
- Immunogen
- TRIM72 antibody was raised using the middle region of TRIM72 corresponding to a region with amino acids LEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAH
- Top Product
- Discover our top product TRIM72 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRIM72 Blocking Peptide, catalog no. 33R-4890, is also available for use as a blocking control in assays to test for specificity of this TRIM72 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM72 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRIM72 (Tripartite Motif Containing 72 (TRIM72))
- Alternative Name
- TRIM72 (TRIM72 Products)
- Synonyms
- Trim72 antibody, MG53 antibody, Mg53 antibody, BC067209 antibody, RGD1562778 antibody, tripartite motif containing 72 antibody, tripartite motif containing 72, E3 ubiquitin protein ligase L homeolog antibody, tripartite motif-containing 72 antibody, TRIM72 antibody, trim72.L antibody, Trim72 antibody
- Background
- TRIM72 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger and 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of TRIM72 remains unknown.
- Molecular Weight
- 53 kDa (MW of target protein)
-