TRIM72 antibody (N-Term)

Catalog No. ABIN631346

Product Details anti-TRIM72 Antibody

Target: TRIM72 (Tripartite Motif Containing 72 (TRIM72))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM72 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRIM72 antibody was raised against the N terminal of TRIM72

Purification: Affinity purified

Immunogen: TRIM72 antibody was raised using the N terminal of TRIM72 corresponding to a region with amino acids CASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM72 Blocking Peptide, catalog no. 33R-1646, is also available for use as a blocking control in assays to test for specificity of this TRIM72 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM72 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM72

Target: TRIM72 (Tripartite Motif Containing 72 (TRIM72))

Alternative Name: TRIM72 (TRIM72 Products)

Synonyms: Trim72 antibody, MG53 antibody, Mg53 antibody, BC067209 antibody, RGD1562778 antibody, tripartite motif containing 72 antibody, tripartite motif containing 72, E3 ubiquitin protein ligase L homeolog antibody, tripartite motif-containing 72 antibody, TRIM72 antibody, trim72.L antibody, Trim72 antibody

Background: TRIM72 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger and 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of TRIM72 remains unknown.

Molecular Weight: 53 kDa (MW of target protein)