RNF160 antibody (N-Term)

Catalog No. ABIN631341

Product Details anti-RNF160 Antibody

Target: RNF160 (ZNF294) (Zinc Finger Protein 294 (ZNF294))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF160 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZNF294 antibody was raised against the N terminal of ZNF294

Purification: Affinity purified

Immunogen: ZNF294 antibody was raised using the N terminal of ZNF294 corresponding to a region with amino acids MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZNF294 Blocking Peptide, catalog no. 33R-6032, is also available for use as a blocking control in assays to test for specificity of this ZNF294 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF294 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF160

Target: RNF160 (ZNF294) (Zinc Finger Protein 294 (ZNF294))

Alternative Name: ZNF294 (ZNF294 Products)

Synonyms: C21orf10 antibody, C21orf98 antibody, RNF160 antibody, ZNF294 antibody, Zfp-294 antibody, 4930528H02Rik antibody, AV266914 antibody, C87237 antibody, Listerin antibody, Rnf160 antibody, Zfp294 antibody, Znf294 antibody, listerin E3 ubiquitin protein ligase 1 antibody, LTN1 antibody, Ltn1 antibody

Background: ZNF294 may function as an E3 ubiquitin-protein ligase. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Molecular Weight: 200 kDa (MW of target protein)