RNF160 antibody (N-Term)
-
- Target See all RNF160 (ZNF294) Antibodies
- RNF160 (ZNF294) (Zinc Finger Protein 294 (ZNF294))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNF160 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZNF294 antibody was raised against the N terminal of ZNF294
- Purification
- Affinity purified
- Immunogen
- ZNF294 antibody was raised using the N terminal of ZNF294 corresponding to a region with amino acids MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA
- Top Product
- Discover our top product ZNF294 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZNF294 Blocking Peptide, catalog no. 33R-6032, is also available for use as a blocking control in assays to test for specificity of this ZNF294 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF294 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF160 (ZNF294) (Zinc Finger Protein 294 (ZNF294))
- Alternative Name
- ZNF294 (ZNF294 Products)
- Synonyms
- C21orf10 antibody, C21orf98 antibody, RNF160 antibody, ZNF294 antibody, Zfp-294 antibody, 4930528H02Rik antibody, AV266914 antibody, C87237 antibody, Listerin antibody, Rnf160 antibody, Zfp294 antibody, Znf294 antibody, listerin E3 ubiquitin protein ligase 1 antibody, LTN1 antibody, Ltn1 antibody
- Background
- ZNF294 may function as an E3 ubiquitin-protein ligase. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
- Molecular Weight
- 200 kDa (MW of target protein)
-