METTL2B antibody (N-Term)
-
- Target See all METTL2B Antibodies
- METTL2B (Methyltransferase Like 2B (METTL2B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This METTL2B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- METTL2 B antibody was raised against the N terminal of METTL2
- Purification
- Affinity purified
- Immunogen
- METTL2 B antibody was raised using the N terminal of METTL2 corresponding to a region with amino acids AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE
- Top Product
- Discover our top product METTL2B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
METTL2B Blocking Peptide, catalog no. 33R-1229, is also available for use as a blocking control in assays to test for specificity of this METTL2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- METTL2B (Methyltransferase Like 2B (METTL2B))
- Alternative Name
- METTL2B (METTL2B Products)
- Synonyms
- METL antibody, METTL2 antibody, METTL2A antibody, PSENIP1 antibody, Mettl2 antibody, methyltransferase like 2B antibody, METTL2B antibody, Mettl2b antibody
- Background
- METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized.
- Molecular Weight
- 43 kDa (MW of target protein)
-