LIPT1 antibody (N-Term)
-
- Target See all LIPT1 Antibodies
- LIPT1 (Lipoyltransferase 1 (LIPT1))
- Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LIPT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LIPT1 antibody was raised against the N terminal of LIPT1
- Purification
- Affinity purified
- Immunogen
- LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE
- Top Product
- Discover our top product LIPT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LIPT1 Blocking Peptide, catalog no. 33R-6654, is also available for use as a blocking control in assays to test for specificity of this LIPT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIPT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LIPT1 (Lipoyltransferase 1 (LIPT1))
- Alternative Name
- LIPT1 (LIPT1 Products)
- Background
- The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, LIPT1 transfers the lipoyl moiety to apoproteins.
- Molecular Weight
- 42 kDa (MW of target protein)
-