TRIM55 antibody (N-Term)

Catalog No. ABIN631327

Product Details anti-TRIM55 Antibody

Target: TRIM55 (Tripartite Motif Containing 55 (TRIM55))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM55 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRIM55 antibody was raised against the N terminal of TRIM55

Purification: Affinity purified

Immunogen: TRIM55 antibody was raised using the N terminal of TRIM55 corresponding to a region with amino acids SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM55 Blocking Peptide, catalog no. 33R-8464, is also available for use as a blocking control in assays to test for specificity of this TRIM55 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM55 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM55

Target: TRIM55 (Tripartite Motif Containing 55 (TRIM55))

Alternative Name: TRIM55 (TRIM55 Products)

Synonyms: MURF-2 antibody, RNF29 antibody, muRF2 antibody, trim55 antibody, wu:fb71c01 antibody, zgc:92123 antibody, TRIM55 antibody, im:7145460 antibody, zgc:136833 antibody, D830041C10Rik antibody, Murf2 antibody, Rnf29 antibody, murf-2 antibody, rnf29 antibody, tripartite motif containing 55 antibody, tripartite motif containing 55a antibody, tripartite motif containing 55b antibody, tripartite motif-containing 55 antibody, tripartite motif containing 55 L homeolog antibody, TRIM55 antibody, trim55a antibody, trim55b antibody, Trim55 antibody, trim55.L antibody

Background: TRIM55 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres.

Molecular Weight: 60 kDa (MW of target protein)