SPDYA antibody
-
- Target See all SPDYA Antibodies
- SPDYA (Speedy Homolog A (SPDYA))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPDYA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SPDYA antibody was raised using a synthetic peptide corresponding to a region with amino acids HTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK
- Top Product
- Discover our top product SPDYA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SPDYA Blocking Peptide, catalog no. 33R-3860, is also available for use as a blocking control in assays to test for specificity of this SPDYA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPDYA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPDYA (Speedy Homolog A (SPDYA))
- Alternative Name
- SPDYA (SPDYA Products)
- Synonyms
- zgc:101624 antibody, 4921517J08Rik antibody, 4930548B21Rik antibody, GS4 antibody, MLZ-465 antibody, Spdy1 antibody, RINGO antibody, SPDY1 antibody, RINGO3 antibody, RINGOA antibody, SPY1 antibody, Gs4 antibody, Lm23 antibody, Spy1 antibody, speedy homolog A (Xenopus laevis) antibody, speedy/RINGO cell cycle regulator family member A antibody, speedy/RINGO cell cycle regulator family, member A antibody, SPDYA antibody, spdya antibody, Spdya antibody
- Background
- SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.
- Molecular Weight
- 36 kDa (MW of target protein)
-