RNF165 antibody (Middle Region)

Catalog No. ABIN631316

Product Details anti-RNF165 Antibody

Target: RNF165 (Ring Finger Protein 165 (RNF165))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF165 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RNF165 antibody was raised against the middle region of RNF165

Purification: Affinity purified

Immunogen: RNF165 antibody was raised using the middle region of RNF165 corresponding to a region with amino acids SSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLG

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF165 Blocking Peptide, catalog no. 33R-8857, is also available for use as a blocking control in assays to test for specificity of this RNF165 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF165 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF165

Target: RNF165 (Ring Finger Protein 165 (RNF165))

Alternative Name: RNF165 (RNF165 Products)

Synonyms: RNF165 antibody, ARKL2 antibody, 2900024M11Rik antibody, AI427432 antibody, G630064H08Rik antibody, Gm96 antibody, RGD1560744 antibody, si:ch73-29c22.3 antibody, ring finger protein 165 antibody, ring finger protein 165a antibody, RNF165 antibody, Rnf165 antibody, rnf165a antibody

Background: RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.

Molecular Weight: 38 kDa (MW of target protein)