RUFY1 antibody (C-Term)

Catalog No. ABIN631310

Product Details anti-RUFY1 Antibody

Target: RUFY1 (RUN and FYVE Domain Containing 1 (RUFY1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RUFY1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RUFY1 antibody was raised against the C terminal of RUFY1

Purification: Affinity purified

Immunogen: RUFY1 antibody was raised using the C terminal of RUFY1 corresponding to a region with amino acids QCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RUFY1 Blocking Peptide, catalog no. 33R-7487, is also available for use as a blocking control in assays to test for specificity of this RUFY1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RUFY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RUFY1

Target: RUFY1 (RUN and FYVE Domain Containing 1 (RUFY1))

Alternative Name: RUFY1 (RUFY1 Products)

Synonyms: RABIP4 antibody, ZFYVE12 antibody, 3000002E04Rik antibody, Rabip4 antibody, rabip4 antibody, zfyve12 antibody, RUN and FYVE domain containing 1 antibody, RUN and FYVE domain containing 1 L homeolog antibody, RUFY1 antibody, Rufy1 antibody, rufy1 antibody, rufy1.L antibody

Background: RUFY1 contains 1 FYVE-type zinc finger and 1 RUN domain. It binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in early endosomal trafficking.

Molecular Weight: 69 kDa (MW of target protein)