LCMT2 antibody (C-Term)

Catalog No. ABIN631299

Product Details anti-LCMT2 Antibody

Target: LCMT2 (Leucine Carboxyl Methyltransferase 2 (LCMT2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LCMT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LCMT2 antibody was raised against the C terminal of LCMT2

Purification: Affinity purified

Immunogen: LCMT2 antibody was raised using the C terminal of LCMT2 corresponding to a region with amino acids PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LCMT2 Blocking Peptide, catalog no. 33R-7414, is also available for use as a blocking control in assays to test for specificity of this LCMT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCMT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LCMT2

Target: LCMT2 (Leucine Carboxyl Methyltransferase 2 (LCMT2))

Alternative Name: LCMT2 (LCMT2 Products)

Synonyms: si:ch211-194d6.3 antibody, wu:fi38a08 antibody, PPM2 antibody, TYW4 antibody, D330024M17 antibody, Tyw4 antibody, leucine carboxyl methyltransferase 2 antibody, hypothetical protein antibody, tRNA methyltransferase antibody, ANI_1_1244164 antibody, AOR_1_496094 antibody, PTRG_08920 antibody, BDBG_01006 antibody, MCYG_03718 antibody, MGYG_03321 antibody, PGTG_17062 antibody, lcmt2 antibody, CAALFM_C101150CA antibody, LCMT2 antibody, Lcmt2 antibody

Background: LCMT2 belongs to the highly variable methyltransferase superfamily. This gene is the inferred homolog of the Saccharomyces cerevisiae carboxymethyltransferase gene PPM2 that is essential for the synthesis of the hypermodified guanosine Wybutosine (yW).

Molecular Weight: 75 kDa (MW of target protein)