PRTFDC1 antibody (N-Term)

Catalog No. ABIN631292

Product Details anti-PRTFDC1 Antibody

Target: PRTFDC1 (phosphoribosyl Transferase Domain Containing 1 (PRTFDC1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRTFDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRTFDC1 antibody was raised against the N terminal of PRTFDC1

Purification: Affinity purified

Immunogen: PRTFDC1 antibody was raised using the N terminal of PRTFDC1 corresponding to a region with amino acids AGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRTFDC1 Blocking Peptide, catalog no. 33R-1226, is also available for use as a blocking control in assays to test for specificity of this PRTFDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRTFDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRTFDC1

Target: PRTFDC1 (phosphoribosyl Transferase Domain Containing 1 (PRTFDC1))

Alternative Name: PRTFDC1 (PRTFDC1 Products)

Synonyms: HHGP antibody, HPRT antibody, hprt1 antibody, hprt1l antibody, zgc:55561 antibody, zgc:86771 antibody, MGC80959 antibody, OTTMUSG00000011667 antibody, Prtfdc1 antibody, phosphoribosyl transferase domain containing 1 antibody, phosphoribosyl transferase domain containing 1 L homeolog antibody, phosphoribosyltransferase domain containing 1 pseudogene antibody, PRTFDC1 antibody, prtfdc1 antibody, Prtfdc1 antibody, prtfdc1.L antibody, Gm13377 antibody

Background: PRTFDC1 belongs to the purine/pyrimidine phosphoribosyltransferase family. Epigenetic silencing of PRTFDC1 by hypermethylation of the CpG islands leads to a loss of PRTFDC1 function, which might be involved in squamous cell oral carcinogenesis.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process