PRKRIP1 antibody
-
- Target See all PRKRIP1 Antibodies
- PRKRIP1 (Prkr Interacting Protein 1 (IL11 Inducible) (PRKRIP1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRKRIP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PRKRIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPE
- Top Product
- Discover our top product PRKRIP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRKRIP1 Blocking Peptide, catalog no. 33R-5756, is also available for use as a blocking control in assays to test for specificity of this PRKRIP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKRIP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKRIP1 (Prkr Interacting Protein 1 (IL11 Inducible) (PRKRIP1))
- Alternative Name
- PRKRIP1 (PRKRIP1 Products)
- Synonyms
- C114 antibody, KRBOX3 antibody, 8430424D23Rik antibody, PRKR interacting protein 1 antibody, Prkr interacting protein 1 (IL11 inducible) antibody, PRKR interacting protein 1 (IL11 inducible) antibody, PRKR interacting protein 1) L homeolog antibody, PRKRIP1 antibody, Prkrip1 antibody, prkrip1 antibody, prkrip1.L antibody
- Background
- PRKRIP1 binds double-stranded RNA. It inhibits EIF2AK2 kinase activity.
- Molecular Weight
- 21 kDa (MW of target protein)
-