Selenoprotein P antibody (N-Term)

Catalog No. ABIN631287

Product Details anti-Selenoprotein P Antibody

Target: Selenoprotein P (SEPP1)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Selenoprotein P antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SEPP1 antibody was raised against the N terminal of SEPP1

Purification: Affinity purified

Immunogen: SEPP1 antibody was raised using the N terminal of SEPP1 corresponding to a region with amino acids LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SEPP1 Blocking Peptide, catalog no. 33R-4984, is also available for use as a blocking control in assays to test for specificity of this SEPP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEPP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Selenoprotein P

Target: Selenoprotein P (SEPP1)

Alternative Name: SEPP1 (SEPP1 Products)

Synonyms: SELP antibody, SeP antibody, AU018766 antibody, D15Ucla1 antibody, Se-P antibody, selp antibody, sepp1 antibody, MGC88974 antibody, SEPP1 antibody, SEP antibody, DKFZp459B039 antibody, SePPb antibody, SelPb antibody, cb689 antibody, fb59b06 antibody, id:ibd5022 antibody, sePb antibody, wu:fb59b06 antibody, SePPa antibody, SelPa antibody, cb688 antibody, wu:fa55a04 antibody, wu:fb38a09 antibody, wu:fj79f04 antibody, selenoprotein P antibody, selenoprotein P1 antibody, selenoprotein P2-like antibody, selenoprotein P2 antibody, SELENOP antibody, Selenop antibody, SELENOP1 antibody, selenop2l antibody, SeP antibody, selenop2 antibody, selenop antibody

Background: SEPP1 is a selenoprotein containing multiple selenocysteine (Sec) residues, which are encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This selenoprotein is an extracellular glycoprotein, and is unusual in that it contains 10 Sec residues per polypeptide. It is a heparin-binding protein that appears to be associated with endothelial cells, and has been implicated to function as an antioxidant in the extracellular space.

Molecular Weight: 46 kDa (MW of target protein)