PANK4 antibody (N-Term)

Catalog No. ABIN631283

Product Details anti-PANK4 Antibody

Target: PANK4 (Pantothenate Kinase 4 (PANK4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PANK4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PANK4 antibody was raised against the N terminal of PANK4

Purification: Affinity purified

Immunogen: PANK4 antibody was raised using the N terminal of PANK4 corresponding to a region with amino acids MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PANK4 Blocking Peptide, catalog no. 33R-5630, is also available for use as a blocking control in assays to test for specificity of this PANK4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PANK4

Target: PANK4 (Pantothenate Kinase 4 (PANK4))

Alternative Name: PANK4 (PANK4 Products)

Synonyms: zgc:66285 antibody, MGC142618 antibody, D030031I12Rik antibody, R75150 antibody, Fang1 antibody, pantothenate kinase 4 antibody, pank4 antibody, PANK4 antibody, LOC100283180 antibody, Pank4 antibody

Background: This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells.

Molecular Weight: 86 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process