RHPN1 antibody (Middle Region)

Catalog No. ABIN631270

Product Details anti-RHPN1 Antibody

Target: RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHPN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RHPN1 antibody was raised against the middle region of RHPN1

Purification: Affinity purified

Immunogen: RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RHPN1 Blocking Peptide, catalog no. 33R-8917, is also available for use as a blocking control in assays to test for specificity of this RHPN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHPN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RHPN1

Target: RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))

Alternative Name: RHPN1 (RHPN1 Products)

Synonyms: si:ch1073-260o7.1 antibody, ODF5 antibody, RHOPHILIN antibody, RHPN antibody, BB023497 antibody, Grbp antibody, Rhophilin antibody, mKIAA1929 antibody, rhophilin, Rho GTPase binding protein 1 antibody, rhophilin Rho GTPase binding protein 1 antibody, rhpn1 antibody, RHPN1 antibody, Rhpn1 antibody

Background: RHPN1 has no enzymatic activity. RHPN1 may serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules.

Molecular Weight: 73 kDa (MW of target protein)