TSKS antibody (N-Term)

Catalog No. ABIN631260

Product Details anti-TSKS Antibody

Target: TSKS (Testis-Specific serine Kinase Substrate (TSKS))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSKS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TSKS antibody was raised against the N terminal of TSKS

Purification: Affinity purified

Immunogen: TSKS antibody was raised using the N terminal of TSKS corresponding to a region with amino acids MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TSKS Blocking Peptide, catalog no. 33R-5767, is also available for use as a blocking control in assays to test for specificity of this TSKS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSKS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSKS

Target: TSKS (Testis-Specific serine Kinase Substrate (TSKS))

Alternative Name: TSKS (TSKS Products)

Synonyms: TSKS antibody, STK22S1 antibody, TSKS1 antibody, TSSKS antibody, Stk22s1 antibody, Tssks1 antibody, testis specific serine kinase substrate antibody, testis-specific serine kinase substrate antibody, TSKS antibody, Tsks antibody

Background: TSKS may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of TSKS is highest in the testis and down-regulated in testicular cancer.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Toll-Like Receptors Cascades