TDO2 antibody (N-Term)

Catalog No. ABIN631259

Product Details anti-TDO2 Antibody

Target: TDO2 (Tryptophan 2,3-Dioxygenase (TDO2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TDO2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TDO2 antibody was raised against the N terminal of TDO2

Purification: Affinity purified

Immunogen: TDO2 antibody was raised using the N terminal of TDO2 corresponding to a region with amino acids LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TDO2 Blocking Peptide, catalog no. 33R-4940, is also available for use as a blocking control in assays to test for specificity of this TDO2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TDO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TDO2

Target: TDO2 (Tryptophan 2,3-Dioxygenase (TDO2))

Alternative Name: TDO2 (TDO2 Products)

Background: Tryptophan 2,3-dioxygenase (EC 1.13.11.11) plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.

Molecular Weight: 48 kDa (MW of target protein)