TDO2 antibody (N-Term)

Catalog No. ABIN631259

Product Details anti-TDO2 Antibody

Target: TDO2 (Tryptophan 2,3-Dioxygenase (TDO2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TDO2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TDO2 antibody was raised against the N terminal of TDO2

Purification: Affinity purified

Immunogen: TDO2 antibody was raised using the N terminal of TDO2 corresponding to a region with amino acids LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TDO2 Blocking Peptide, catalog no. 33R-4940, is also available for use as a blocking control in assays to test for specificity of this TDO2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TDO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TDO2

Target: TDO2 (Tryptophan 2,3-Dioxygenase (TDO2))

Alternative Name: TDO2 (TDO2 Products)

Synonyms: Tdo2 antibody, tdo2l antibody, fi30d08 antibody, zgc:63488 antibody, wu:fi30d08 antibody, TDO2 antibody, fb62b10 antibody, tdo2 antibody, wu:fb62b10 antibody, zgc:103693 antibody, DDBDRAFT_0190495 antibody, DDBDRAFT_0231363 antibody, DDB_0190495 antibody, DDB_0231363 antibody, TDO antibody, TO antibody, TPH2 antibody, TRPO antibody, AA407491 antibody, chky antibody, Tdo antibody, tryptophan 2,3-dioxygenase b antibody, tryptophan 2,3-dioxygenase antibody, tryptophan 2,3-dioxygenase a antibody, tryptophan 2,3-dioxygenase L homeolog antibody, tdo2b antibody, tdo2 antibody, TDO2 antibody, MADE_02822 antibody, CtCNB1_3657 antibody, tdo2a antibody, CNC04830 antibody, tdo antibody, Mrub_2119 antibody, Deipr_2235 antibody, Acav_1166 antibody, Mesop_4278 antibody, Tdo2 antibody, tdo2.L antibody

Background: Tryptophan 2,3-dioxygenase (EC 1.13.11.11) plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.

Molecular Weight: 48 kDa (MW of target protein)