-
- Target See all WASF3 Antibodies
- WASF3 (WAS Protein Family, Member 3 (WASF3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WASF3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- WASF3 antibody was raised against the N terminal of WASF3
- Purification
- Affinity purified
- Immunogen
- WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK
- Top Product
- Discover our top product WASF3 Primary Antibody
-
anti-WAS Protein Family, Member 3 (WASF3) (AA 368-502) antibody
WASF3 Reactivity: Human WB, ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (Internal Region) antibodyWASF3 Reactivity: Human, Mouse, Rat WB, ELISA, IHC, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (AA 1-499) antibodyWASF3 Reactivity: Human WB, IP Host: Rabbit Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (AA 1-499) antibodyWASF3 Reactivity: Human WB Host: Mouse Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (AA 21-120) antibodyWASF3 Reactivity: Mouse, Rat WB, ELISA, FACS, IF (cc), IF (p), IHC (p), ICC, IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (AA 96-145) antibodyWASF3 Reactivity: Human, Mouse, Dog, Guinea Pig, Horse, Monkey, Cow, Rabbit, Zebrafish (Danio rerio), Bat, Chicken, Pig WB Host: Rabbit Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (AA 184-233) antibodyWASF3 Reactivity: Human, Mouse, Dog, Guinea Pig, Horse, Monkey, Rabbit, Bat, Chicken, Xenopus laevis WB Host: Rabbit Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (AA 35-208) antibodyWASF3 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (AA 200-300) antibodyWASF3 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (N-Term) antibodyWASF3 Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Cow, Rabbit, Zebrafish (Danio rerio) WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WASF3 Blocking Peptide, catalog no. 33R-6796, is also available for use as a blocking control in assays to test for specificity of this WASF3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WASF3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WASF3 (WAS Protein Family, Member 3 (WASF3))
- Alternative Name
- WASF3 (WASF3 Products)
- Synonyms
- wu:fb74d08 antibody, wu:fi28e02 antibody, zgc:158236 antibody, Brush-1 antibody, SCAR3 antibody, WAVE3 antibody, Scar3 antibody, Wave3 antibody, WAS protein family, member 3b antibody, WAS protein family member 3 antibody, WAS protein family, member 3 antibody, wasf3b antibody, WASF3 antibody, Wasf3 antibody
- Background
- WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.
- Molecular Weight
- 55 kDa (MW of target protein)
- Pathways
- RTK Signaling
-
You are here:
