ACP6 antibody (N-Term)

Catalog No. ABIN631247

Product Details anti-ACP6 Antibody

Target: ACP6 (Acid Phosphatase 6, Lysophosphatidic (ACP6))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACP6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACP6 antibody was raised against the N terminal of ACP6

Purification: Affinity purified

Immunogen: ACP6 antibody was raised using the N terminal of ACP6 corresponding to a region with amino acids EADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEWNPQLLEVPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACP6 Blocking Peptide, catalog no. 33R-2253, is also available for use as a blocking control in assays to test for specificity of this ACP6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACP6

Target: ACP6 (Acid Phosphatase 6, Lysophosphatidic (ACP6))

Alternative Name: ACP6 (ACP6 Products)

Synonyms: ACP6 antibody, im:7147584 antibody, zgc:172268 antibody, MGC146066 antibody, ACPL1 antibody, LPAP antibody, PACPL1 antibody, 5730559A09Rik antibody, AU022842 antibody, mPACPL1 antibody, acid phosphatase 6, lysophosphatidic antibody, acid phosphatase 6, lysophosphatidic S homeolog antibody, ACP6 antibody, acp6 antibody, acp6.S antibody, Acp6 antibody

Background: ACP6 could hydrolyze lysophosphatidic acid to monoacylglycerol. It was originally reported to be located in the mitochondrion, but the evidence seems to be weak and contradictory with the presence of a cleaved signal sequence.

Molecular Weight: 49 kDa (MW of target protein)