UMPS antibody (C-Term)

Catalog No. ABIN631243

Product Details anti-UMPS Antibody

Target: UMPS (Uridine Monophosphate Synthetase (UMPS))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UMPS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UMPS antibody was raised against the C terminal of UMPS

Purification: Affinity purified

Immunogen: UMPS antibody was raised using the C terminal of UMPS corresponding to a region with amino acids VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UMPS Blocking Peptide, catalog no. 33R-9552, is also available for use as a blocking control in assays to test for specificity of this UMPS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UMPS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UMPS

Target: UMPS (Uridine Monophosphate Synthetase (UMPS))

Alternative Name: UMPS (UMPS Products)

Synonyms: zgc:55702 antibody, zgc:55723 antibody, UMPS antibody, OPRT antibody, 1700095D23Rik antibody, AA408257 antibody, AL033308 antibody, BB164745 antibody, Orotidine 5'-phosphate decarboxylase antibody, uridine monophosphate synthetase antibody, uridine monophosphate synthetase L homeolog antibody, uridine 5'-monophosphate synthase antibody, umps-1 antibody, umps antibody, umps.L antibody, UMPS antibody, LOC100556619 antibody, Umps antibody

Background: OPRT (UMPS) is involved in early events of pancreatic and gallbladder carcinogenesis and invasion of hepatocellular carcinomas. Orotate phosphoribosyltransferase is involved in the invasion and metastasis of colorectal carcinoma. Determination of OPRT levels in gastric carcinoma tissue enables to predict the response to S-1-based neoadjuvant/adjuvant chemotherapy.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process