PHKG2 antibody
-
- Target See all PHKG2 Antibodies
- PHKG2 (phosphorylase Kinase, gamma 2 (Testis) (PHKG2))
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PHKG2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- PHKG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV
- Top Product
- Discover our top product PHKG2 Primary Antibody
-
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (AA 237-406) antibody
PHKG2 Reactivity: Human WB, IF Host: Rabbit Polyclonal unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (AA 304-334) antibodyPHKG2 Reactivity: Human, Mouse WB, IHC (p) Host: Rabbit Polyclonal RB03701-03702 unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (AA 41-71), (N-Term) antibodyPHKG2 Reactivity: Human, Mouse WB, IHC (p) Host: Rabbit Polyclonal RB3699 unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (AA 1-406) antibodyPHKG2 Reactivity: Human WB, ELISA, IF Host: Mouse Monoclonal 2B8 unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (AA 237-406) antibodyPHKG2 Reactivity: Human WB, IHC, ELISA Host: Rabbit Polyclonal unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (AA 1-216) antibodyPHKG2 Reactivity: Human WB, IF, FACS Host: Mouse Monoclonal 2A3 unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (AA 1-406) antibodyPHKG2 Reactivity: Human WB, IP Host: Rabbit Polyclonal unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (N-Term) antibodyPHKG2 Reactivity: Human, Dog, Rabbit, Cow, Sheep, Goat, Guinea Pig, Bat, Monkey, Pig WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (N-Term) antibodyPHKG2 Reactivity: Human, Mouse, Rat, Dog, Rabbit, Cow, Sheep, Goat, Guinea Pig, Zebrafish (Danio rerio) WB, IHC Host: Rabbit Polyclonal unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (N-Term) antibodyPHKG2 Reactivity: Human, Mouse WB, IHC (p), EIA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PHKG2 Blocking Peptide, catalog no. 33R-2309, is also available for use as a blocking control in assays to test for specificity of this PHKG2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHKG2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHKG2 (phosphorylase Kinase, gamma 2 (Testis) (PHKG2))
- Alternative Name
- PHKG2 (PHKG2 Products)
- Synonyms
- PHKG2 antibody, MGC145608 antibody, zgc:55863 antibody, GSD9C antibody, 1500017I02Rik antibody, phosphorylase kinase catalytic subunit gamma 2 antibody, phosphorylase kinase, gamma 2 (testis) antibody, phosphorylase kinase, gamma 2 (testis) L homeolog antibody, PHKG2 antibody, phkg2 antibody, phkg2.L antibody, Phkg2 antibody
- Background
- Mutations in PHKG2 along with PHKA2 and PHKB, all three different genes of phosphorylase kinase (Phk) subunits, can give rise to glycogen storage disease of the liver. The autosomal-recessive, liver-specific variant of Phk deficiency is caused by mutations in the gene encoding the testis/liver isoform of the catalytic gamma subunit, PHKG2.
- Molecular Weight
- 46 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process, Regulation of Carbohydrate Metabolic Process
-
