MPP3 antibody

Catalog No. ABIN631235

Product Details anti-MPP3 Antibody

Target: MPP3 (Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPP3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: MPP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAVALAEDVMEELQAASV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPP3 Blocking Peptide, catalog no. 33R-7863, is also available for use as a blocking control in assays to test for specificity of this MPP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPP3

Target: MPP3 (Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3))

Alternative Name: MPP3 (MPP3 Products)

Synonyms: DLG3 antibody, 6430514B01 antibody, Dlgh3 antibody, CSG18 antibody, Dlg3 antibody, Dusp3 antibody, si:ch73-368i2.1 antibody, membrane palmitoylated protein 3 antibody, membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3) antibody, membrane protein, palmitoylated 3a (MAGUK p55 subfamily member 3) antibody, MPP3 antibody, Mpp3 antibody, mpp3a antibody

Background: This gene product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions

Molecular Weight: 66 kDa (MW of target protein)