-
- Target See all TJP2 Antibodies
- TJP2 (Tight Junction Protein 2 (Zona Occludens 2) (TJP2))
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TJP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TJP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVVPETNKEPRYQEDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKK
- Top Product
- Discover our top product TJP2 Primary Antibody
-
anti-Tight Junction Protein 2 (Zona Occludens 2) (TJP2) (AA 307-669) antibody
TJP2 Reactivity: Human WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Tight Junction Protein 2 (Zona Occludens 2) (TJP2) (AA 951-1190) antibodyTJP2 Reactivity: Human WB, IP Host: Rabbit Polyclonal unconjugated
anti-Tight Junction Protein 2 (Zona Occludens 2) (TJP2) (AA 1165-1183) antibodyTJP2 Reactivity: Human WB, ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Tight Junction Protein 2 (Zona Occludens 2) (TJP2) (AA 121-218) antibodyTJP2 Reactivity: Human WB, ELISA Host: Mouse Monoclonal 4D12 unconjugated
anti-Tight Junction Protein 2 (Zona Occludens 2) (TJP2) (C-Term) antibodyTJP2 Reactivity: Human, Mouse, Rat, Dog WB, IHC, IF, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Tight Junction Protein 2 (Zona Occludens 2) (TJP2) (pSer978) antibodyTJP2 Reactivity: Human DB Host: Rabbit Polyclonal RB41329 unconjugated
anti-Tight Junction Protein 2 (Zona Occludens 2) (TJP2) (AA 981-1009), (C-Term) antibodyTJP2 Reactivity: Human WB Host: Rabbit Polyclonal RB36845 unconjugated
anti-Tight Junction Protein 2 (Zona Occludens 2) (TJP2) antibodyTJP2 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Tight Junction Protein 2 (Zona Occludens 2) (TJP2) (AA 468-517) antibodyTJP2 Reactivity: Human, Dog WB Host: Rabbit Polyclonal unconjugated
anti-Tight Junction Protein 2 (Zona Occludens 2) (TJP2) (C-Term) antibodyTJP2 Reactivity: Human, Rat, Dog, Cow, Guinea Pig, Rabbit, Pig, Chicken WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TJP2 Blocking Peptide, catalog no. 33R-9376, is also available for use as a blocking control in assays to test for specificity of this TJP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TJP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TJP2 (Tight Junction Protein 2 (Zona Occludens 2) (TJP2))
- Alternative Name
- TJP2 (TJP2 Products)
- Synonyms
- C9DUPq21.11 antibody, DFNA51 antibody, DUP9q21.11 antibody, X104 antibody, ZO2 antibody, ZO-2 antibody, zo2 antibody, tjp2 antibody, x104 antibody, zo-2 antibody, wu:fb62b09 antibody, zgc:92094 antibody, tight junction protein 2 antibody, tight junction protein 2 L homeolog antibody, tight junction protein 2b (zona occludens 2) antibody, TJP2 antibody, Tjp2 antibody, tjp2.L antibody, tjp2b antibody
- Background
- Tight junction proteins (TJPs) belong to a family of membrane-associated guanylate kinase (MAGUK) homologs that are involved in the organization of epithelial and endothelial intercellular junctions. TJPs bind to the cytoplasmic C termini of junctional transmembrane proteins and link them to the actin cytoskeleton.
- Molecular Weight
- 134 kDa (MW of target protein)
-
You are here:
