PKC zeta antibody (N-Term)
-
- Target See all PKC zeta (PRKCZ) Antibodies
- PKC zeta (PRKCZ) (Protein Kinase C, zeta (PRKCZ))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PKC zeta antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRKCZ antibody was raised against the N terminal of PRKCZ
- Purification
- Affinity purified
- Immunogen
- PRKCZ antibody was raised using the N terminal of PRKCZ corresponding to a region with amino acids MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKP
- Top Product
- Discover our top product PRKCZ Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRKCZ Blocking Peptide, catalog no. 33R-5876, is also available for use as a blocking control in assays to test for specificity of this PRKCZ antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCZ antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PKC zeta (PRKCZ) (Protein Kinase C, zeta (PRKCZ))
- Alternative Name
- PRKCZ (PRKCZ Products)
- Synonyms
- TPKC antibody, PKCzeta antibody, prkcz-A antibody, pkc-zeta antibody, PRKCZ antibody, pkc2 antibody, PKC-ZETA antibody, PKC2 antibody, AI098070 antibody, C80388 antibody, Pkcz antibody, R74924 antibody, aPKCzeta antibody, zetaPKC antibody, 14-3-3-zetaisoform antibody, r14-3-3 antibody, pkcz antibody, si:ch211-150o23.4 antibody, protein kinase C zeta L homeolog antibody, protein kinase C zeta antibody, protein kinase C, zeta antibody, prkcz.L antibody, PRKCZ antibody, prkcz antibody, Prkcz antibody
- Background
- Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine.
- Molecular Weight
- 45 kDa (MW of target protein)
- Pathways
- NF-kappaB Signaling, RTK Signaling, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling
-