RAPSN antibody (N-Term)

Catalog No. ABIN631223

Product Details anti-RAPSN Antibody

Target: RAPSN (Receptor-Associated Protein of The Synapse (RAPSN))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAPSN antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAPSN antibody was raised against the N terminal of RAPSN

Purification: Affinity purified

Immunogen: RAPSN antibody was raised using the N terminal of RAPSN corresponding to a region with amino acids MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLV

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAPSN Blocking Peptide, catalog no. 33R-6061, is also available for use as a blocking control in assays to test for specificity of this RAPSN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPSN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAPSN

Target: RAPSN (Receptor-Associated Protein of The Synapse (RAPSN))

Alternative Name: RAPSN (RAPSN Products)

Synonyms: RAPSN antibody, RAPSYN antibody, RNF205 antibody, 43kDa antibody, Nraps antibody, Raps antibody, rapsyn antibody, receptor associated protein of the synapse antibody, receptor associated protein of the synapse S homeolog antibody, receptor-associated protein of the synapse antibody, receptor-associated protein of the synapse, 43kD antibody, RAPSN antibody, rapsn.S antibody, Rapsn antibody, rapsn antibody

Background: RAPSN belongs to a family of proteins that are receptor associated proteins of the synapse. It contains a conserved cAMP-dependent protein kinase phosphorylation site. It is believed to play some role in anchoring or stabilizing the nicotinic acetylcholine receptor at synaptic sites. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin.

Molecular Weight: 39 kDa (MW of target protein)