TJAP1 antibody

Catalog No. ABIN631222

Product Details anti-TJAP1 Antibody

Target: TJAP1 (Tight Junction Associated Protein 1 (Peripheral) (TJAP1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TJAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TJAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTSAAPAKKPYRKAPPEHRELRLEIPGSRLEQEEPLTDAERMKLLQEENE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TJAP1 Blocking Peptide, catalog no. 33R-6560, is also available for use as a blocking control in assays to test for specificity of this TJAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TJAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TJAP1

Target: TJAP1 (Tight Junction Associated Protein 1 (Peripheral) (TJAP1))

Alternative Name: TJAP1 (TJAP1 Products)

Synonyms: 0610041D19Rik antibody, AI415281 antibody, AW121008 antibody, Pilt antibody, Tjp4 antibody, TJP4 antibody, PILT antibody, tight junction associated protein 1 antibody, Tjap1 antibody, TJAP1 antibody

Background: TJAP1 interacts with DLG1. The exact function of TJAP1 remains unknown.

Molecular Weight: 15 kDa (MW of target protein)