Ubiquilin 3 antibody (N-Term)

Catalog No. ABIN631218

Product Details anti-Ubiquilin 3 Antibody

Target: Ubiquilin 3 (UBQLN3)

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Ubiquilin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Ubiquilin 3 antibody was raised against the N terminal of UBQLN3

Purification: Affinity purified

Immunogen: Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Ubiquilin 3 Blocking Peptide, catalog no. 33R-5210, is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBQLN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Ubiquilin 3

Target: Ubiquilin 3 (UBQLN3)

Alternative Name: Ubiquilin 3 (UBQLN3 Products)

Synonyms: TUP-1 antibody, 4933400K24Rik antibody, UBQLN3 antibody, ubiquilin 3 antibody, UBQLN3 antibody, Ubqln3 antibody

Background: UBQLN3 is an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.

Molecular Weight: 72 kDa (MW of target protein)