PFN1 antibody (N-Term)
-
- Target See all PFN1 Antibodies
- PFN1 (Profilin 1 (PFN1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PFN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Profilin 1 antibody was raised against the N terminal of PFN1
- Purification
- Affinity purified
- Immunogen
- Profilin 1 antibody was raised using the N terminal of PFN1 corresponding to a region with amino acids AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL
- Top Product
- Discover our top product PFN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Profilin 1 Blocking Peptide, catalog no. 33R-1234, is also available for use as a blocking control in assays to test for specificity of this Profilin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PFN1 (Profilin 1 (PFN1))
- Alternative Name
- Profilin 1 (PFN1 Products)
- Background
- PFN1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome.
- Molecular Weight
- 15 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization, Tube Formation, Maintenance of Protein Location
-