AASDHPPT antibody (C-Term)

Catalog No. ABIN631211

Product Details anti-AASDHPPT Antibody

Target: AASDHPPT (Aminoadipate-Semialdehyde Dehydrogenase-phosphopantetheinyl Transferase (AASDHPPT))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AASDHPPT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AASDHPPT antibody was raised against the C terminal of AASDHPPT

Purification: Affinity purified

Immunogen: AASDHPPT antibody was raised using the C terminal of AASDHPPT corresponding to a region with amino acids SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AASDHPPT Blocking Peptide, catalog no. 33R-8756, is also available for use as a blocking control in assays to test for specificity of this AASDHPPT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AASDHPPT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AASDHPPT

Target: AASDHPPT (Aminoadipate-Semialdehyde Dehydrogenase-phosphopantetheinyl Transferase (AASDHPPT))

Alternative Name: AASDHPPT (AASDHPPT Products)

Synonyms: AASD-PPT antibody, LYS2 antibody, LYS5 antibody, 2010309J24Rik antibody, 2810407B07Rik antibody, CGI-80 antibody, AASDHPPT antibody, DDBDRAFT_0186752 antibody, DDBDRAFT_0304576 antibody, DDB_0186752 antibody, DDB_0304576 antibody, aasdhppt antibody, aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase antibody, aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase S homeolog antibody, AASDHPPT antibody, Aasdhppt antibody, Bm1_31065 antibody, DDB_G0285927 antibody, aasdhppt antibody, aasdhppt.S antibody

Background: AASDHPPT is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia.

Molecular Weight: 36 kDa (MW of target protein)