-
- Target See all UBR1 Antibodies
- UBR1 (Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UBR1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- UBR1 antibody was raised against the N terminal of UBR1
- Purification
- Affinity purified
- Immunogen
- UBR1 antibody was raised using the N terminal of UBR1 corresponding to a region with amino acids YKQLQKEYISDDHDRSISITALSVQMFTVPTLARHLIEEQNVISVITETL
- Top Product
- Discover our top product UBR1 Primary Antibody
-
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 2-100) antibody
UBR1 Reactivity: Human WB, ELISA Host: Mouse Monoclonal 2F5 unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 722-862) antibodyUBR1 Reactivity: Human ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 245-274), (N-Term) antibodyUBR1 Reactivity: Mouse WB Host: Rabbit Polyclonal RB41861 unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 2-100) antibodyUBR1 Reactivity: Human WB, ELISA Host: Mouse Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 2-100) antibodyUBR1 Reactivity: Human ELISA, IF Host: Mouse Monoclonal 4G7 unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 801-900) antibodyUBR1 Reactivity: Human, Mouse WB, ELISA, IF (cc), IF (p), IHC (fro), IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (Internal Region) antibodyUBR1 Reactivity: Human, Mouse WB, ELISA, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 396-445) antibodyUBR1 Reactivity: Human, Dog, Rabbit, Monkey, Guinea Pig, Bat WB Host: Rabbit Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (N-Term) antibodyUBR1 Reactivity: Human, Mouse, Rat, Dog, Cow, Horse, Rabbit, Guinea Pig, Saccharomyces cerevisiae WB Host: Rabbit Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (Internal Region) antibodyUBR1 Reactivity: Human, Mouse WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UBR1 Blocking Peptide, catalog no. 33R-10155, is also available for use as a blocking control in assays to test for specificity of this UBR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBR1 (Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1))
- Alternative Name
- UBR1 (UBR1 Products)
- Synonyms
- Dmel\\CG9086 antibody, Ubr1 antibody, UBR1 antibody, JBS antibody, AI504731 antibody, RGD1562326 antibody, Ubr1 ubiquitin ligase antibody, ubiquitin protein ligase E3 component n-recognin 1 antibody, E3 ubiquitin-protein ligase ubr-1 antibody, Ubr1 antibody, ubr1 antibody, UBR1 antibody, ubr-1 antibody
- Background
- UBR1 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. recognises and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
- Molecular Weight
- 200 kDa (MW of target protein)
-
You are here:
