UBR1 antibody (N-Term)
-
- Target See all UBR1 Antibodies
- UBR1 (Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UBR1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- UBR1 antibody was raised against the N terminal of UBR1
- Purification
- Affinity purified
- Immunogen
- UBR1 antibody was raised using the N terminal of UBR1 corresponding to a region with amino acids YKQLQKEYISDDHDRSISITALSVQMFTVPTLARHLIEEQNVISVITETL
- Top Product
- Discover our top product UBR1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UBR1 Blocking Peptide, catalog no. 33R-10155, is also available for use as a blocking control in assays to test for specificity of this UBR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBR1 (Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1))
- Alternative Name
- UBR1 (UBR1 Products)
- Background
- UBR1 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. recognises and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
- Molecular Weight
- 200 kDa (MW of target protein)
-