AMD1 antibody (N-Term)

Catalog No. ABIN631207

Product Details anti-AMD1 Antibody

Target: AMD1 (Adenosylmethionine Decarboxylase 1 (AMD1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AMD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AMD1 antibody was raised against the N terminal of AMD1

Purification: Affinity purified

Immunogen: AMD1 antibody was raised using the N terminal of AMD1 corresponding to a region with amino acids MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AMD1 Blocking Peptide, catalog no. 33R-6068, is also available for use as a blocking control in assays to test for specificity of this AMD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AMD1

Target: AMD1 (Adenosylmethionine Decarboxylase 1 (AMD1))

Alternative Name: AMD1 (AMD1 Products)

Synonyms: ADOMETDC antibody, AMD antibody, SAMDC antibody, Amd1a antibody, Amd1b antibody, AMD1 antibody, AdoMetDC antibody, amd antibody, samdc antibody, fb26e03 antibody, si:ch211-257g8.2 antibody, wu:fb26e03 antibody, zgc:55614 antibody, 1 antibody, Amd-1 antibody, SAMDC 1 antibody, adoMetDC1 antibody, CG5029 antibody, Dmel\\CG5029 antibody, l(2)31Dc antibody, l(2)31Dd antibody, l(2)31De antibody, F16B3.10 antibody, F16B3_10 antibody, S-ADENOSYLMETHIONINE DECARBOXYLASE antibody, S-adenosylmethionine decarboxylase antibody, adenosylmethionine decarboxylase 1 antibody, S-adenosylmethionine decarboxylase 1 antibody, S-adenosyl methionine decarboxylase 2 antibody, adenosylmethionine decarboxylase 1 L homeolog antibody, S-adenosylmethionine decarboxylase antibody, AMD1 antibody, Amd1 antibody, amd1 antibody, sam2 antibody, amd1.L antibody, SamDC antibody, SAMDC antibody

Background: The specific function of AMD1 is not yet known.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process