PRAME antibody (N-Term)

Catalog No. ABIN631203

Product Details anti-PRAME Antibody

Target: PRAME (Preferentially Expressed Antigen in Melanoma (PRAME))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRAME antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRAME antibody was raised against the N terminal of PRAME

Purification: Affinity purified

Immunogen: PRAME antibody was raised using the N terminal of PRAME corresponding to a region with amino acids MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRAME Blocking Peptide, catalog no. 33R-5955, is also available for use as a blocking control in assays to test for specificity of this PRAME antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRAME antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRAME

Target: PRAME (Preferentially Expressed Antigen in Melanoma (PRAME))

Alternative Name: PRAME (PRAME Products)

Synonyms: PRAME antibody, CT130 antibody, MAPE antibody, OIP-4 antibody, OIP4 antibody, 4930534P07Rik antibody, preferentially expressed antigen in melanoma antibody, PRAME antibody, Prame antibody

Background: PRAME functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. PRAME prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Retinoic Acid Receptor Signaling Pathway, Nuclear Hormone Receptor Binding