IFT122 antibody
-
- Target See all IFT122 Antibodies
- IFT122 (Intraflagellar Transport 122 (IFT122))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IFT122 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- IFT122 antibody was raised using a synthetic peptide corresponding to a region with amino acids QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS
- Top Product
- Discover our top product IFT122 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IFT122 Blocking Peptide, catalog no. 33R-7457, is also available for use as a blocking control in assays to test for specificity of this IFT122 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFT122 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IFT122 (Intraflagellar Transport 122 (IFT122))
- Alternative Name
- IFT122 (IFT122 Products)
- Synonyms
- C86139 antibody, Wdr10 antibody, sopb antibody, CED antibody, CED1 antibody, SPG antibody, WDR10 antibody, WDR10p antibody, WDR140 antibody, intraflagellar transport 122 antibody, intraflagellar transport protein 122 homolog antibody, IFT122 antibody, ift122 antibody, LOC100639275 antibody, LOC100649523 antibody, Ift122 antibody
- Background
- IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. IFT122 contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation.
- Molecular Weight
- 129 kDa (MW of target protein)
- Pathways
- Tube Formation, Embryonic Body Morphogenesis
-