Rhotekin antibody (N-Term)

Catalog No. ABIN631197

Product Details anti-Rhotekin Antibody

Target: Rhotekin (RTKN)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Rhotekin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Rhotekin antibody was raised against the N terminal of RTKN

Purification: Affinity purified

Immunogen: Rhotekin antibody was raised using the N terminal of RTKN corresponding to a region with amino acids DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Rhotekin Blocking Peptide, catalog no. 33R-2163, is also available for use as a blocking control in assays to test for specificity of this Rhotekin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTKN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Rhotekin

Target: Rhotekin (RTKN)

Alternative Name: Rhotekin (RTKN Products)

Synonyms: RTKN antibody, rhotekin antibody, RTKN antibody, rtkn antibody, Rtkn antibody

Background: RTKN mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. RTKN may play a novel role in the organization of septin structures.

Molecular Weight: 63 kDa (MW of target protein)