CLECL1 antibody (N-Term)

Catalog No. ABIN631187

Product Details anti-CLECL1 Antibody

Target: CLECL1 (C-Type Lectin-Like 1 (CLECL1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLECL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CLECL1 antibody was raised against the N terminal of CLECL1

Purification: Affinity purified

Immunogen: CLECL1 antibody was raised using the N terminal of CLECL1 corresponding to a region with amino acids MVSNFFHVIQVFEKSATLISKTEHIGFVIYSWRKSTTHLGSRRKFAISIY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLECL1 Blocking Peptide, catalog no. 33R-6608, is also available for use as a blocking control in assays to test for specificity of this CLECL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLECL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLECL1

Target: CLECL1 (C-Type Lectin-Like 1 (CLECL1))

Alternative Name: CLECL1 (CLECL1 Products)

Synonyms: DCAL-1 antibody, DCAL1 antibody, C-type lectin like 1 antibody, CLECL1 antibody

Background: DCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells. It interacts with subsets of T cells as a costimulatory molecule that enhances interleukin-4 production.

Molecular Weight: 19 kDa (MW of target protein)