OMP antibody (Middle Region)
-
- Target See all OMP Antibodies
- OMP (Olfactory Marker Protein (OMP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OMP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- OMP antibody was raised against the middle region of OMP
- Purification
- Affinity purified
- Immunogen
- OMP antibody was raised using the middle region of OMP corresponding to a region with amino acids WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA
- Top Product
- Discover our top product OMP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OMP Blocking Peptide, catalog no. 33R-10003, is also available for use as a blocking control in assays to test for specificity of this OMP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OMP (Olfactory Marker Protein (OMP))
- Alternative Name
- OMP (OMP Products)
- Background
- Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human.
- Molecular Weight
- 19 kDa (MW of target protein)
-