OMP antibody (Middle Region)

Catalog No. ABIN631184

Product Details anti-OMP Antibody

Target: OMP (Olfactory Marker Protein (OMP))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OMP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OMP antibody was raised against the middle region of OMP

Purification: Affinity purified

Immunogen: OMP antibody was raised using the middle region of OMP corresponding to a region with amino acids WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OMP Blocking Peptide, catalog no. 33R-10003, is also available for use as a blocking control in assays to test for specificity of this OMP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OMP

Target: OMP (Olfactory Marker Protein (OMP))

Alternative Name: OMP (OMP Products)

Synonyms: omp antibody, zgc:101697 antibody, xomp1 antibody, xomp2 antibody, omp2-A antibody, MGC75776 antibody, OMP antibody, zgc:114158 antibody, olfactory marker protein antibody, olfactory marker protein b antibody, olfactory marker protein L homeolog antibody, olfactory marker protein S homeolog antibody, olfactory marker protein a antibody, Omp antibody, OMP antibody, ompb antibody, omp.L antibody, omp.S antibody, omp antibody, ompa antibody

Background: Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human.

Molecular Weight: 19 kDa (MW of target protein)