SULT2B1 antibody (N-Term)
-
- Target See all SULT2B1 Antibodies
- SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SULT2B1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SULT2 B1 antibody was raised against the N terminal of SULT2 1
- Purification
- Affinity purified
- Immunogen
- SULT2 B1 antibody was raised using the N terminal of SULT2 1 corresponding to a region with amino acids MASPPPFHSQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFI
- Top Product
- Discover our top product SULT2B1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SULT2B1 Blocking Peptide, catalog no. 33R-5757, is also available for use as a blocking control in assays to test for specificity of this SULT2B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))
- Alternative Name
- SULT2B1 (SULT2B1 Products)
- Synonyms
- HSST2 antibody, AI326997 antibody, BB173635 antibody, ST2B1 antibody, SULT2B antibody, SULT2B1 antibody, MGC79784 antibody, sulfotransferase family 2B member 1 antibody, sulfotransferase family, cytosolic, 2B, member 1 antibody, sulfotransferase family 2B member 1 L homeolog antibody, SULT2B1 antibody, Sult2b1 antibody, sult2b1 antibody, sult2b1.L antibody
- Background
- Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-