SULT2B1 antibody (C-Term)

Catalog No. ABIN631179

Product Details anti-SULT2B1 Antibody

Target: SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SULT2B1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SULT2 B1 antibody was raised against the C terminal of SULT2 1

Purification: Affinity purified

Immunogen: SULT2 B1 antibody was raised using the C terminal of SULT2 1 corresponding to a region with amino acids NTMSNYTLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SULT2B1 Blocking Peptide, catalog no. 33R-6902, is also available for use as a blocking control in assays to test for specificity of this SULT2B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SULT2B1

Target: SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))

Alternative Name: SULT2B1 (SULT2B1 Products)

Synonyms: HSST2 antibody, AI326997 antibody, BB173635 antibody, ST2B1 antibody, SULT2B antibody, SULT2B1 antibody, MGC79784 antibody, sulfotransferase family 2B member 1 antibody, sulfotransferase family, cytosolic, 2B, member 1 antibody, sulfotransferase family 2B member 1 L homeolog antibody, SULT2B1 antibody, Sult2b1 antibody, sult2b1 antibody, sult2b1.L antibody

Background: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis